Antibody data

Product number
H00006883-M11
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006883-M11, RRID:AB_1137058
Product name
TAF12 monoclonal antibody (M11), clone 1E10
Provider product page
Abnova Corporation - H00006883-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant TAF12.
Antigen sequence
MNQFGPSALINLSNFSSIKPEPASTPPQGSMANST
AVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREV
DPNEQLDEDVEEMLLQIADDFIESVVTAACQLARH
RKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYK
KACTTEAHKQRMALIRKTTKK
Isotype
IgG
Antibody clone number
1E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -