HPA008519

TAF12 antibody from Atlas Antibodies
TAF2J, TAFII20
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008519
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008519, RRID:AB_1080181
Product name
Anti-TAF12
Provider product page
Atlas Antibodies - HPA008519
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPG
AGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDV
EEMLLQIADDFIESVVTAACQLARHRKSSTLEVKD
VQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQ
RMALIR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -