HPA008519

TAF12 antibody from Atlas Antibodies
TAF2J, TAFII20
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008519
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008519, RRID:AB_888978
Product name
Anti-TAF12
Provider product page
Atlas Antibodies - HPA008519
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
NLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPG
AGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDV
EEMLLQIADDFIESVVTAACQLARHRKSSTLEVKD
VQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQ
RMALIR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -