HPA008519

TAF12 antibody from MilliporeSigma / Merck KGaA
TAF2J, TAFII20
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008519
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA008519, RRID:AB_1080181
Product name
Anti-TAF12 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA008519
Antibody type
Polyclonal
Antigen
Transcription initiation factor TFIID subunit 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPG
AGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDV
EEMLLQIADDFIESVVTAACQLARHRKSSTLEVKD
VQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQ
RMALIR
Storage
-20C
Provider Type Product Number
- No reagents -