Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003614-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003614-M01, RRID:AB_606453
- Product name
- IMPDH1 monoclonal antibody (M01), clone 3G6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IMPDH1.
- Antigen sequence
TDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTM
GSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIEL
VVAPAGVTLKEANEILQRSKKGKLPIVNDC- Isotype
- IgG
- Antibody clone number
- 3G6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Novel direct targets of miR-19a identified in breast cancer cells by a quantitative proteomic approach.
Hydroxamic acid derivatives of mycophenolic acid inhibit histone deacetylase at the cellular level.
Ouchida M, Kanzaki H, Ito S, Hanafusa H, Jitsumori Y, Tamaru S, Shimizu K
PloS one 2012;7(8):e44095
PloS one 2012;7(8):e44095
Hydroxamic acid derivatives of mycophenolic acid inhibit histone deacetylase at the cellular level.
Batovska DI, Kim DH, Mitsuhashi S, Cho YS, Kwon HJ, Ubukata M
Bioscience, biotechnology, and biochemistry 2008 Oct;72(10):2623-31
Bioscience, biotechnology, and biochemistry 2008 Oct;72(10):2623-31
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IMPDH1 monoclonal antibody (M01), clone 3G6. Western Blot analysis of IMPDH1 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IMPDH1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol