HPA021234

MRPL10 antibody from Sigma-Aldrich
L10MT, MGC17973, MRP-L10, MRP-L8, MRPL8, RPML8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021234
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021234, RRID:AB_1854098
Product name
Anti-MRPL10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021234
Antibody type
Polyclonal
Antigen
39S ribosomal protein L10, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NVALSAEDKLLMRHQLRKHKILMKVFPNQVLKPFL
EDSKYQNLLPLFVGHNMLLVSEEPKVKEMVRILRT
VPFLPLLGGC
Storage
-20C
Provider Type Product Number
- No reagents -