HPA024734

SH3GLB2 antibody from Sigma-Aldrich
KIAA1848
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024734
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024734, RRID:AB_1856821
Product name
Anti-SH3GLB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024734
Antibody type
Polyclonal
Antigen
Endophilin-B2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HDFVKSQTTYYAQCYRHMLDLQKQLGRFPGTFVGT
TEPASPPLSSTSPTTAAATMPVVPSVASLAPPGEA
SLCLEEVAPPASGTRKARVLY
Storage
-20C
Provider Type Product Number
- No reagents -