HPA016655

KCNQ5 antibody from Sigma-Aldrich
Kv7.5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA016655
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA016655, RRID:AB_1855557
Product name
Anti-KCNQ5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA016655
Antibody type
Polyclonal
Antigen
Potassium voltage-gated channel subfamily KQT member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LALASFQIPPFECEQTSDYQSPVDSKDLSGSAQNS
GCLSRSTSANISRGLQFILTPNEFSAQTFYALSPT
MHSQATQVPISQSDGSAVAATNTIANQINTAPKPA
APTTLQIPPPL
Storage
-20C
Provider Type Product Number
- No reagents -