Antibody data

Product number
PAB21460
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21460, RRID:AB_10984669
Product name
LRRC46 polyclonal antibody
Provider product page
Abnova Corporation - PAB21460
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human LRRC46.
Reactivity
Human
Host
Rabbit
Antigen sequence
PTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAV
SSPQASSPTKKPCSLIPRGHQSSFWGRKGARAATA
PKASVAEAPSTTKTT
Isotype
IgG
Vial size
100 μl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -