HPA021882

LRRC46 antibody from Sigma-Aldrich
MGC16309
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021882
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021882, RRID:AB_1853320
Product name
Anti-LRRC46 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021882
Antibody type
Polyclonal
Antigen
Leucine-rich repeat-containing protein 46 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PTLTDLPLLPGVPMAGDSSPSATPAQGEETVPEAV
SSPQASSPTKKPCSLIPRGHQSSFWGRKGARAATA
PKASVAEAPSTTKTT
Storage
-20C
Provider Type Product Number
- No reagents -