HPA022934

SCRN2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022934
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022934, RRID:AB_1856638
Product name
Anti-SCRN2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022934
Antibody type
Polyclonal
Antigen
Secernin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSIGTDISAQHPELRTHAQAKGWWDGQGAFDFAQI
FSLTQQPVRMEAAKARFQAGRELLRQRQGGITAEV
MMGILRDKESGICMDS
Storage
-20C
Provider Type Product Number
- No reagents -