HPA023434

SCRN2 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023434
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023434, RRID:AB_1856639
Product name
Anti-SCRN2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023434
Antibody type
Polyclonal
Antigen
Secernin-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SVFKPFIFGVGVAQAPQVLSPTFGAQDPVRTLPRF
QTQVDRRHTLYRGHQAALGLMERDQDRGQQLQQKQ
QDLEQEGLEATQGLLAGEWAPPLWEL
Storage
-20C
Provider Type Product Number
- No reagents -