Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000341-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000341-M01, RRID:AB_425310
- Product name
- APOC1 monoclonal antibody (M01), clone 2E2-1A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant APOC1.
- Antigen sequence
MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALD
KLKEFGNTLEDKARELISRIKQSELSAKMREWFSE
TFQKVKEKLKIDS- Isotype
- IgG
- Antibody clone number
- 2E2-1A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Amphipathic α-helices in apolipoproteins are crucial to the formation of infectious hepatitis C virus particles.
Proteins related to lipoprotein profile were identified using a pharmaco-proteomic approach as markers for growth response to growth hormone (GH) treatment in short prepubertal children.
Apolipoprotein c1 association with hepatitis C virus.
Fukuhara T, Wada M, Nakamura S, Ono C, Shiokawa M, Yamamoto S, Motomura T, Okamoto T, Okuzaki D, Yamamoto M, Saito I, Wakita T, Koike K, Matsuura Y
PLoS pathogens 2014 Dec;10(12):e1004534
PLoS pathogens 2014 Dec;10(12):e1004534
Proteins related to lipoprotein profile were identified using a pharmaco-proteomic approach as markers for growth response to growth hormone (GH) treatment in short prepubertal children.
Andersson B, Hellgren G, Nierop AF, Hochberg Z, Albertsson-Wikland K
Proteome science 2009 Nov 2;7:40
Proteome science 2009 Nov 2;7:40
Apolipoprotein c1 association with hepatitis C virus.
Meunier JC, Russell RS, Engle RE, Faulk KN, Purcell RH, Emerson SU
Journal of virology 2008 Oct;82(19):9647-56
Journal of virology 2008 Oct;82(19):9647-56
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- APOC1 monoclonal antibody (M01), clone 2E2-1A3. Western Blot analysis of APOC1 expression in human liver.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of APOC1 expression in transfected 293T cell line by APOC1 monoclonal antibody (M01), clone 2E2-1A3.Lane 1: APOC1 transfected lysate(9 KDa).Lane 2: Non-transfected lysate.