Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008807-M04 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008807-M04, RRID:AB_606445
- Product name
- IL18RAP monoclonal antibody (M04), clone 4G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IL18RAP.
- Antigen sequence
FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKS
HFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPS
NGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSY
ICRPK- Isotype
- IgG
- Antibody clone number
- 4G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Gene expression profiling in the synovium identifies a predictive signature of absence of response to adalimumab therapy in rheumatoid arthritis.
Association study of the IL18RAP locus in three European populations with coeliac disease.
Badot V, Galant C, Nzeusseu Toukap A, Theate I, Maudoux AL, Van den Eynde BJ, Durez P, Houssiau FA, Lauwerys BR
Arthritis research & therapy 2009;11(2):R57
Arthritis research & therapy 2009;11(2):R57
Association study of the IL18RAP locus in three European populations with coeliac disease.
Koskinen LL, Einarsdottir E, Dukes E, Heap GA, Dubois P, Korponay-Szabo IR, Kaukinen K, Kurppa K, Ziberna F, Vatta S, Not T, Ventura A, Sistonen P, Adány R, Pocsai Z, Széles G, Mäki M, Kere J, Wijmenga C, van Heel DA, Saavalainen P
Human molecular genetics 2009 Mar 15;18(6):1148-55
Human molecular genetics 2009 Mar 15;18(6):1148-55
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of IL18RAP expression in transfected 293T cell line by IL18RAP monoclonal antibody (M04), clone 4G4.Lane 1: IL18RAP transfected lysate (Predicted MW: 68.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged IL18RAP is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
