PAB20452

TSHZ3 antibody from Abnova Corporation
KIAA1474, TSH3, ZNF537

Antibody data

Product number
PAB20452
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20452, RRID:AB_10968430
Product name
TSHZ3 polyclonal antibody
Provider product page
Abnova Corporation - PAB20452
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant TSHZ3.
Antigen sequence
TNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPK
RATPSPCSSEVGEPIKMEASSDGGFRSQENSPSPP
RDGCKDGSPLAEPVENGKELVKPLASSLSGSTAII
TDHP
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -