HPA008834

TSHZ3 antibody from Atlas Antibodies
KIAA1474, TSH3, ZNF537
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008834
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008834, RRID:AB_1080731
Product name
Anti-TSHZ3
Provider product page
Atlas Antibodies - HPA008834
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPK
RATPSPCSSEVGEPIKMEASSDGGFRSQENSPSPP
RDGCKDGSPLAEPVENGKELVKPLASSLSGSTAII
TDHP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -