HPA008834

TSHZ3 antibody from Sigma-Aldrich
KIAA1474, TSH3, ZNF537
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008834
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008834, RRID:AB_1080731
Product name
Anti-TSHZ3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008834
Antibody type
Polyclonal
Antigen
Teashirt homolog 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPK
RATPSPCSSEVGEPIKMEASSDGGFRSQENSPSPP
RDGCKDGSPLAEPVENGKELVKPLASSLSGSTAII
TDHP
Storage
-20C
Provider Type Product Number
- No reagents -