H00120103-B01P

SLC36A4 antibody from Abnova Corporation
FLJ38932, PAT4
No application information provided.

Antibody data

Product number
H00120103-B01P
Provider
Abnova Corporation
Product name
SLC36A4 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00120103-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SLC36A4 protein.
Antigen sequence
MEAAATPAAAGAARREELDMDVMRPLINEQNFDGT
SDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLK
GNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVH
CMHILVRCSHFLCLRFKKSTLGYSDTVSFAMEVSP
WSCLQKQAAWGRSVVDFFLVITQLGFCSVYIVFLA
ENVKQVHEGFLESKVFISNSTNSSNPCERRSVDIR
IYMLCFLPFIILLVFIRELKNLFVLSFLANVSMAV
SLVIIYQYVVRNMPDPHNLPIVAGWKKYPLFFGTA
VFAFEGIGVVLPLENQMKESKRFPQALNIGMGIVT
TLYVTLATLGYMCFHDEIKGSITLNLPQDVWLYQS
VKILYSFGIFVTYSIQFYVPAEIIIHGITSKFHTK
WKQICEFGIRSFLVSITCAGAILIPRLDIVISFVG
AVSSSTLAIILPPLVEILTFSKEHYNIWMVLKNIS
IAFTGVVGFLLGTYITVEEIIYPTPKVVAGTPQSP
FLNLNSTCLTSGLK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -