PAB20973

SLC36A4 antibody from Abnova Corporation
FLJ38932, PAT4

Antibody data

Product number
PAB20973
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20973, RRID:AB_10961888
Product name
SLC36A4 polyclonal antibody
Provider product page
Abnova Corporation - PAB20973
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant SLC36A4.
Antigen sequence
REELDMDVMRPLINEQNFDGTSDEEHEQELLPVQK
HYQLDDQEGISFVQTLMHLLKGNIGTGL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -