HPA017887

SLC36A4 antibody from Sigma-Aldrich
FLJ38932, PAT4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017887
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017887, RRID:AB_2190238
Product name
Anti-SLC36A4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017887
Antibody type
Polyclonal
Antigen
Proton-coupled amino acid transporter 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
REELDMDVMRPLINEQNFDGTSDEEHEQELLPVQK
HYQLDDQEGISFVQTLMHLLKGNIGTGL
Storage
-20C
Provider Type Product Number
- No reagents -