HPA017887

SLC36A4 antibody from Atlas Antibodies
FLJ38932, PAT4
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017887
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017887, RRID:AB_2190238
Product name
Anti-SLC36A4
Provider product page
Atlas Antibodies - HPA017887
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
REELDMDVMRPLINEQNFDGTSDEEHEQELLPVQK
HYQLDDQEGISFVQTLMHLLKGNIGTGL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -