PAB21319

FAM71F1 antibody from Abnova Corporation
FAM137A, NYD-SP18

Antibody data

Product number
PAB21319
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21319, RRID:AB_10965632
Product name
FAM71F1 polyclonal antibody
Provider product page
Abnova Corporation - PAB21319
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human FAM71F1.
Reactivity
Human
Host
Rabbit
Antigen sequence
LSFRSSRKVETNKNSSGKDSSREDSIPCTCDLRWR
ASFTYGEWERENPSGLQPLSLLSTLAASTGPQLAP
PIGNSI
Isotype
IgG
Vial size
100 μl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.