Antibody data

Product number
PAB21401
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21401, RRID:AB_10967976
Product name
FAM71F1 polyclonal antibody
Provider product page
Abnova Corporation - PAB21401
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human FAM71F1.
Reactivity
Human
Host
Rabbit
Antigen sequence
GLSITTKDPRILVTHCLVPKNCSSPSGDSKLVQKK
LQASQPSESLIQLMTKGESEALSQIFADLHQQNQ
Isotype
IgG
Vial size
100 μl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.