HPA021409

FAM71F1 antibody from Sigma-Aldrich
FAM137A, NYD-SP18
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021409
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021409, RRID:AB_2101627
Product name
Anti-FAM71F1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021409
Antibody type
Polyclonal
Antigen
Protein FAM71F1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLSITTKDPRILVTHCLVPKNCSSPSGDSKLVQKK
LQASQPSESLIQLMTKGESEALSQIFADLHQQNQ
Storage
-20C
Provider Type Product Number
- No reagents -