Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055163-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055163-A01, RRID:AB_606801
- Product name
- PNPO polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PNPO.
- Antigen sequence
KSSQIGAVVSHQSSVIPDREYLRKKNEELEQLYQD
QEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVF
RRGLPTGDSPLGPMTHRGEEDWLYERLAP- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Toxicological biomarkers of 2,3,4,7,8-pentachlorodibenzofuran in proteins secreted by HepG2 cells.
PNPO deficiency: an under diagnosed inborn error of pyridoxine metabolism.
Phark S, Park SY, Choi S, Zheng Z, Cho E, Lee M, Lim JY, Seo JB, Won NH, Jung WW, Sul D
Biochimica et biophysica acta 2012 Apr;1824(4):656-66
Biochimica et biophysica acta 2012 Apr;1824(4):656-66
PNPO deficiency: an under diagnosed inborn error of pyridoxine metabolism.
Khayat M, Korman SH, Frankel P, Weintraub Z, Hershckowitz S, Sheffer VF, Ben Elisha M, Wevers RA, Falik-Zaccai TC
Molecular genetics and metabolism 2008 Aug;94(4):431-4
Molecular genetics and metabolism 2008 Aug;94(4):431-4
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PNPO polyclonal antibody (A01), Lot # 060529JCS1 Western Blot analysis of PNPO expression in MES-SA/Dx5 ( Cat # L021V1 ).