ABIN311193

DOLPP1 antibody from antibodies-online
LSFR2
Western blot
Data presented on provider website

Antibody data

Product number
ABIN311193
Provider
antibodies-online
Product name
anti-Dolichyl Pyrophosphate Phosphatase 1 (DOLPP1) (N-Term) antibody
Provider product page
antibodies-online - ABIN311193
Antibody type
Polyclonal
Antigen
The immunogen for anti-DOLPP1 antibody: synthetic peptide directed towards the N terminal of human DOLPP1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
AADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYL
SLSPV FVIVGFVTLI
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.