HPA019179

DOLPP1 antibody from Sigma-Aldrich
LSFR2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019179
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019179, RRID:AB_1847827
Product name
Anti-DOLPP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019179
Antibody type
Polyclonal
Antigen
Dolichyldiphosphatase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQEVLTPLFPRIAAWPVSEFFLIRDTSLIPNVLWF
EYTVTRAEARNRQRKLGTKL
Storage
-20C
Provider Type Product Number
- No reagents -