HPA022918

PRR15L antibody from Sigma-Aldrich
ATAD4, MGC11242
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022918
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022918, RRID:AB_2060743
Product name
Anti-ATAD4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022918
Antibody type
Polyclonal
Antigen
Protein ATAD4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAE
PPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKVSNS
GRFKEKKKVRATLAENPNLFD
Storage
-20C
Provider Type Product Number
- No reagents -