HPA006204

TSFM antibody from Sigma-Aldrich
EF-TS, EF-Tsmt
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006204
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006204, RRID:AB_1080405
Product name
Anti-TSFM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006204
Antibody type
Polyclonal
Antigen
Elongation factor Ts, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLALAIGKLGENMILKRAAWVKVPSGFYVGSYVHG
AMQSPSLHKLVLGKYGALVICETSEQKTNLEDVGR
RLGQHVVGMAPLSVGSLDDEPGGEAETKMLSQPYL
LDPSITLGQYVQPQGVSVVDFVRFECGEGE
Storage
-20C
Provider Type Product Number
- No reagents -