Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005204-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005204-A01, RRID:AB_462344
- Product name
- PFDN5 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PFDN5.
- Antigen sequence
QTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPG
KLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDF
LTKQMEKIQPALQEKHAMKQAVMEMMSQKI- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Prefoldin subunits are protected from ubiquitin-proteasome system-mediated degradation by forming complex with other constituent subunits.
Negative regulation of the Wnt signal by MM-1 through inhibiting expression of the wnt4 gene.
Miyazawa M, Tashiro E, Kitaura H, Maita H, Suto H, Iguchi-Ariga SM, Ariga H
The Journal of biological chemistry 2011 Jun 3;286(22):19191-203
The Journal of biological chemistry 2011 Jun 3;286(22):19191-203
Negative regulation of the Wnt signal by MM-1 through inhibiting expression of the wnt4 gene.
Yoshida T, Kitaura H, Hagio Y, Sato T, Iguchi-Ariga SM, Ariga H
Experimental cell research 2008 Apr 1;314(6):1217-28
Experimental cell research 2008 Apr 1;314(6):1217-28
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PFDN5 polyclonal antibody (A01), Lot # 050927JC01 Western Blot analysis of PFDN5 expression in 293 ( Cat # L026V1 ).