HPA008587

PFDN5 antibody from MilliporeSigma / Merck KGaA
MM-1, PFD5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008587
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA008587, RRID:AB_1079597
Product name
Anti-PFDN5 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA008587
Antibody type
Polyclonal
Antigen
Prefoldin subunit 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
INITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVV
QTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPG
KLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDF
LTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTA
Storage
-20C
Provider Type Product Number
- No reagents -