Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001384-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001384-A01, RRID:AB_489354
- Product name
- CRAT polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant CRAT.
- Antigen sequence
AIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTD
CVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCA
ETNAARLAHYLEKALLDMRALLQSHPRAKL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Pathogenic cycle between the endogenous nitric oxide synthase inhibitor asymmetrical dimethylarginine and the leukocyte-derived hemoprotein myeloperoxidase.
von Leitner EC, Klinke A, Atzler D, Slocum JL, Lund N, Kielstein JT, Maas R, Schmidt-Haupt R, Pekarova M, Hellwinkel O, Tsikas D, D'Alecy LG, Lau D, Willems S, Kubala L, Ehmke H, Meinertz T, Blankenberg S, Schwedhelm E, Gadegbeku CA, Böger RH, Baldus S, Sydow K
Circulation 2011 Dec 13;124(24):2735-45
Circulation 2011 Dec 13;124(24):2735-45
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CRAT polyclonal antibody (A01). Western Blot analysis of CRAT expression in PC-12.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CRAT expression in transfected 293T cell line by CRAT polyclonal antibody (A01).Lane1:CRAT transfected lysate (Predicted MW: 36.74 KDa).Lane2:Non-transfected lysate.