Antibody data

Product number
HPA049576
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA049576, RRID:AB_2680821
Product name
Anti-ZNF296
Provider product page
Atlas Antibodies - HPA049576
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MSRRKAGSAPRRVEPAPAANPDDEMEMQDLVIELK
PEPDAQPQQAPRLGPFSPKEVSS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -