Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109573 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 296 (ZNF296) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF296 antibody: synthetic peptide directed towards the middle region of human ZNF296.
- Description
- Purified on peptide immunoaffinity column
- Reactivity
- Human, Mouse, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MSRRKAGSAPRRVEPAPAANPDDEMEMQDLVIELK
PEPDAQPQQAPRLGP- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store the lyophised antibody at -20°C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references The contribution of genetic and epigenetic mechanisms to gene silencing in oligodendrogliomas.
Hong C, Bollen AW, Costello JF
Cancer research 2003 Nov 15;63(22):7600-5
Cancer research 2003 Nov 15;63(22):7600-5
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HepG2; WB Suggested Anti-ZNF342 Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate; ZNF342 antibody - middle region (AP42095PU-N) in Human HepG2 cells using Western Blot