Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309972 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 296 (ZNF296) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF342 antibody: synthetic peptide directed towards the N terminal of human ZNF342
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
KLLRHAQWDHGLSIYQTESEAPEAPLLGLAEVAAA
VSAVV GPAAEAKSPR- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The contribution of genetic and epigenetic mechanisms to gene silencing in oligodendrogliomas.
Beta-glucan functions as an adjuvant for monoclonal antibody immunotherapy by recruiting tumoricidal granulocytes as killer cells.
Hong C, Bollen AW, Costello JF
Cancer research 2003 Nov 15;63(22):7600-5
Cancer research 2003 Nov 15;63(22):7600-5
Beta-glucan functions as an adjuvant for monoclonal antibody immunotherapy by recruiting tumoricidal granulocytes as killer cells.
Hong F, Hansen RD, Yan J, Allendorf DJ, Baran JT, Ostroff GR, Ross GD
Cancer research 2003 Dec 15;63(24):9023-31
Cancer research 2003 Dec 15;63(24):9023-31
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting