AV39859

ZNF296 antibody from MilliporeSigma / Merck KGaA
ZNF342
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV39859
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ZNF342 (AB2) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV39859
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF342 with an internal ID of P21870
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TNSSNLTVHRRSHTGERPYTCEFCNYACAQSSKLN
RHRRMHGMTPGSTRF
Storage
-20C