Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009111-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009111-M04, RRID:AB_875742
- Product name
- NMI monoclonal antibody (M04), clone 9E8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NMI.
- Antigen sequence
MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITK
KNIQLKKEIQKLETELQEATKEFQIKEDIPETKMK
FLSVETPENDSQLSNISCSFQVSSKVPYEI- Isotype
- IgG
- Antibody clone number
- 9E8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Nmi interacts with Hsp105β and enhances the Hsp105β-mediated Hsp70 expression.
Saito Y, Yukawa A, Matozaki M, Mikami H, Yamagami T, Yamagishi N, Kuga T, Hatayama T, Nakayama Y
Experimental cell research 2014 Sep 10;327(1):163-70
Experimental cell research 2014 Sep 10;327(1):163-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NMI monoclonal antibody (M04), clone 9E8 Western Blot analysis of NMI expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NMI is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to NMI on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol