Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501448 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-N-Myc (And STAT) Interactor (NMI) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-NMI antibody: synthetic peptide directed towards the middle region of human NMI
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
SFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVAD
KILKK KEYPLYINQT- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Camptothecin-induced apoptosis is enhanced by Myc and involves PKCdelta signaling.
Albihn A, Mo H, Yang Y, Henriksson M
International journal of cancer. Journal international du cancer 2007 Oct 15;121(8):1821-9
International journal of cancer. Journal international du cancer 2007 Oct 15;121(8):1821-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry