HPA008588

NMI antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008588
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008588, RRID:AB_1079493
Product name
Anti-NMI antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008588
Antibody type
Polyclonal
Antigen
N-myc-interactor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVD
RVDYDRQSGSAVITFVEIGVADKILKKKEYPLYIN
QTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGM
EGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSL
GQPH
Storage
-20C
Provider Type Product Number
- No reagents -