HPA021050

SCYL2 antibody from Sigma-Aldrich
CVAK104, KIAA1360
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021050
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021050, RRID:AB_1846175
Product name
Anti-SCYL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021050
Antibody type
Polyclonal
Antigen
SCY1-like protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLF
QRDNLQKSQFFKGLPKVLPKLPKRVIVQRILPCLT
SEFVNPDMVPFVLPNVLLIAEECTKEEYVKLILPE
LGPVFKQQEPIQILLIFLQKMDLLLTKTPPDEIKN
S
Storage
-20C
Provider Type Product Number
- No reagents -