HPA005900

PLAGL2 antibody from Sigma-Aldrich
ZNF900
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005900
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005900, RRID:AB_1079629
Product name
Anti-PLAGL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005900
Antibody type
Polyclonal
Antigen
Zinc finger protein PLAGL2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RHVKKSHSQELLKIKTEPVDMLGLLSCSSTVSVKE
ELSPVLCMASRDVMGTKAFPGMLPMGMYGAHIPTM
PSTGVPHSLVHNTLPMGMSYPLESSPISSPAQLPP
KYQL
Storage
-20C
Provider Type Product Number
- No reagents -