Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009440-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009440-M01, RRID:AB_518743
- Product name
- CRSP6 monoclonal antibody (M01), clone 4D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CRSP6.
- Antigen sequence
FSNHVGLGPIESIGNASAITVASPSGDYAISVRNG
PESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRG
PFKEVQWNKMEGRNFVYKMELLMSALSPCLL- Isotype
- IgG
- Antibody clone number
- 4D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Human mediator MED17 subunit plays essential roles in gene regulation by associating with the transcription and DNA repair machineries.
Identification of target genes for the CDK subunits of the Mediator complex.
Kikuchi Y, Umemura H, Nishitani S, Iida S, Fukasawa R, Hayashi H, Hirose Y, Tanaka A, Sugasawa K, Ohkuma Y
Genes to cells : devoted to molecular & cellular mechanisms 2015 Mar;20(3):191-202
Genes to cells : devoted to molecular & cellular mechanisms 2015 Mar;20(3):191-202
Identification of target genes for the CDK subunits of the Mediator complex.
Tsutsui T, Fukasawa R, Tanaka A, Hirose Y, Ohkuma Y
Genes to cells : devoted to molecular & cellular mechanisms 2011 Dec;16(12):1208-18
Genes to cells : devoted to molecular & cellular mechanisms 2011 Dec;16(12):1208-18
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- CRSP6 monoclonal antibody (M01), clone 4D4 Western Blot analysis of CRSP6 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CRSP6 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CRSP6 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CRSP6 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.2 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol