Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009440-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009440-M02, RRID:AB_875507
- Product name
- CRSP6 monoclonal antibody (M02), clone 1B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CRSP6.
- Antigen sequence
FSNHVGLGPIESIGNASAITVASPSGDYAISVRNG
PESGSKIMVQFPRNQCKDLPKSDVLQDNKWSHLRG
PFKEVQWNKMEGRNFVYKMELLMSALSPCLL- Isotype
- IgG
- Antibody clone number
- 1B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Mediator complex recruits epigenetic regulators via its two cyclin-dependent kinase subunits to repress transcription of immune response genes.
Tsutsui T, Fukasawa R, Shinmyouzu K, Nakagawa R, Tobe K, Tanaka A, Ohkuma Y
The Journal of biological chemistry 2013 Jul 19;288(29):20955-20965
The Journal of biological chemistry 2013 Jul 19;288(29):20955-20965
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CRSP6 monoclonal antibody (M02), clone 1B5 Western Blot analysis of CRSP6 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CRSP6 is approximately 3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to CRSP6 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol