ABIN487064

TAF4 antibody from antibodies-online
TAF2C, TAF2C1, TAF4A, TAFII130, TAFII135

Antibody data

Product number
ABIN487064
Provider
antibodies-online
Product name
anti-TAF4 RNA Polymerase II, TATA Box Binding Protein (TBP)-Associated Factor, 135kDa (TAF4) antibody
Provider product page
antibodies-online - ABIN487064
Antibody type
Polyclonal
Antigen
The immunogen for anti-TAF4 antibody: synthetic peptide directed towards the middle region of human TAF4
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
Host
Rabbit
Antigen sequence
EQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRA
AKSRS RQEDPEQLRL
Vial size
50 µg
Provider Type Product Number
- No reagents -