HPA008599

TAF4 antibody from Sigma-Aldrich
TAF2C, TAF2C1, TAF4A, TAFII130, TAFII135
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008599
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008599, RRID:AB_1080183
Product name
Anti-TAF4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008599
Antibody type
Polyclonal
Antigen
Transcription initiation factor TFIID subunit 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLVRSENGQLLMIPQQALAQMQAQAHAQPQTTMAP
RPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIK
QVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTAS
LGTATAVQTGTPQRTVPGATTTSSAATETMENVKK
CK
Storage
-20C
Provider Type Product Number
- No reagents -