Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182370 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Homeobox B5 (HOXB5) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HOXB5 antibody: synthetic peptide directed towards the N terminal of human HOXB5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine
- Host
- Rabbit
- Antigen sequence
MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYR
DPAAM HTGSYGYNYN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references HOXB5 expression is spatially and temporarily regulated in human embryonic gut during neural crest cell colonization and differentiation of enteric neuroblasts.
Fu M, Lui VC, Sham MH, Cheung AN, Tam PK
Developmental dynamics : an official publication of the American Association of Anatomists 2003 Sep;228(1):1-10
Developmental dynamics : an official publication of the American Association of Anatomists 2003 Sep;228(1):1-10
No comments: Submit comment
No validations: Submit validation data