Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010450-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010450-M02, RRID:AB_534987
- Product name
- PPIE monoclonal antibody (M02), clone 2F5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PPIE.
- Antigen sequence
ATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQ
IPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESE
LFGRTIRVNLAKPMRIKEGSSRPVWSDDD- Isotype
- IgG
- Antibody clone number
- 2F5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PPIE monoclonal antibody (M02), clone 2F5 Western Blot analysis of PPIE expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of PPIE expression in transfected 293T cell line by PPIE monoclonal antibody (M02), clone 2F5.Lane 1: PPIE transfected lysate(33.4 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PPIE monoclonal antibody (M02), clone 2F5. Western Blot analysis of PPIE expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PPIE is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PPIE on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol