Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00053833-B02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00053833-B02, RRID:AB_11189363
- Product name
- IL20RB MaxPab mouse polyclonal antibody (B02)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human IL20RB protein.
- Antigen sequence
MKHLLMWSPVIAPGETVYHSVEYQGEYESLYTSHI
WIPSSWCSLTEGPECDVTDDITATVPYNLRVRATL
GSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHL
VIELEDLGPQFEFLVAYWRREPGAEERPFPWYWPC
LPLLASC- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of IL20RB expression in transfected 293T cell line (H00053833-T02) by IL20RB MaxPab polyclonal antibody.Lane 1: IL20RB transfected lysate(16.28 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of purified MaxPab antibody to IL20RB on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol