HPA019772

IL20RB antibody from Sigma-Aldrich
DIRS1, FNDC6, IL-20R2, MGC34923
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019772
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019772, RRID:AB_1851683
Product name
Anti-IL20RB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019772
Antibody type
Polyclonal
Antigen
Interleukin-20 receptor beta chain Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREE
VDACATAVMSPEELLRAWIS
Storage
-20C
Provider Type Product Number
- No reagents -