Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003219-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003219-M01, RRID:AB_894134
- Product name
- HOXB9 monoclonal antibody (M01), clone 3C8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant HOXB9.
- Antigen sequence
PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWL
EPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTP
EYSLETSAGREAVLSNQRPGYGDNKICEG- Isotype
- IgG
- Antibody clone number
- 3C8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Elevated HOXB9 expression promotes differentiation and predicts a favourable outcome in colon adenocarcinoma patients.
Zhan J, Niu M, Wang P, Zhu X, Li S, Song J, He H, Wang Y, Xue L, Fang W, Zhang H
British journal of cancer 2014 Aug 26;111(5):883-93
British journal of cancer 2014 Aug 26;111(5):883-93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- HOXB9 monoclonal antibody (M01), clone 3C8 Western Blot analysis of HOXB9 expression in HepG2 ( Cat # L019V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged HOXB9 is 1 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol