Antibody data

Product number
H00003219-M06A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003219-M06A, RRID:AB_1576053
Product name
HOXB9 monoclonal antibody (M06A), clone 2E9
Provider product page
Abnova Corporation - H00003219-M06A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HOXB9.
Antigen sequence
PLSPHASGSLPSVYHPYIQPQGVPPAESRYLRTWL
EPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTP
EYSLETSAGREAVLSNQRPGYGDNKICEG
Isotype
IgG
Antibody clone number
2E9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -